PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G409900.1.p
Common NameSb03g044450, SORBIDRAFT_03g044450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 984aa    MW: 110722 Da    PI: 4.9051
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G409900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-14853248
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Sobic.003G409900.1.p  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                          78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  Sobic.003G409900.1.p  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                           68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001678.02E-121053No hitNo description
PfamPF139215.2E-131070No hitNo description
SuperFamilySSF466897.55E-2133107IPR009057Homeodomain-like
CDDcd116592.68E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118319.1E-59406657IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 984 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEANDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRHR KRKRKGIDYN AEIPFEKRPP SGFYDTVGED RPLEHVQFPT  240
TIEELEGKRR ADIEAQLRKQ DIARNKILQR QDAPAAIMQA NKLNDPEAVT KRSKLMLPPP  300
QISDHELEEI AKMGNAGDPA LADELGEGSA ATRTLLASYS QTPRLGMTPL RTPQRTPAGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPELH PSDFSGVTPR KKEIQTPNPM ATPLASPGPG  420
ITPRIGMTPS REGHSFGLTP RGTPFRDELR INEEVEMQDS TKLELRRQAE LKKSLRSGFA  480
SIPQPKNEYQ IVMPPITEDE KEEAEEKIEE DMSDRLARER AEEQARHEVL LRKRSKVLQR  540
SLPRPPAASV EIIWQSLIRS GESRSRSTFV PPTSLEQADE LINEELFRLL EHDNAKYPLD  600
EKTQKEKKKG SKRQQNGGPL VPEIEDFDED ELKEASSMVE EEIQYLRVAM GHENESFEDF  660
VKAHDACQED LMFFPTNNSY GLASVSGNAD KVSALQNEFE TVKKRMDDEA KKASRLEQKI  720
KLLTQGYQVR SGKLWSQVQD TFKQMDTAAT ELGCFQELQK QEHLAASYRI LNLTEEVNKQ  780
KALERTLQSR YGELVSGFQR IEEQLEEHKK QLKVQEAIEA ENRAQEEEVA APNHAAEEED  840
ERKPPSFEEK SQQTSRATDE EAAGSKGTTE DQMDVNSGNG DGGVVGPIPP TPNTEGDDDE  900
VSIQESASNT QSSDCTSTKD GADKIDQAKL EGQDKSDDSM AVDAGPREES KDELVPVGAS  960
ISEENTMVPS DQAVSKEDEG MAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRHRKRKRK
2199204RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.94760.0callus| panicle| pollen| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4589620.0AF458962.1 Zea mays CDC5 protein (CDC5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459012.10.0hypothetical protein SORBIDRAFT_03g044450
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLC5XGY30.0C5XGY3_SORBI; Putative uncharacterized protein Sb03g044450
STRINGSb03g044450.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Representative plantOGRP39481723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5